SCOPe 2.06: Domain d2vhps1: 2vhp S:2-80

Lineage for d2vhps1 (2vhp S:2-80)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
   alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123

4. Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family)
   automatically mapped to Pfam PF00203

5. Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)

6. Protein Ribosomal protein S19 [54572] (2 species)

7. Species Escherichia coli [TaxId:562] [160144] (26 PDB entries)
   Uniprot P0A7U3 2-80

8. Domain d2vhps1: 2vhp S:2-80 [153163]
   Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhpt1, d2vhpu1
   protein/RNA complex; complexed with mg
   protein/RNA complex; complexed with mg

Details for d2vhps1

PDB Entry: 2vhp, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)

PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d2vhps1:

Sequence; same for both SEQRES and ATOM records:

>d2vhps1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]}
rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
tdemvghklgefaptrtyr

Timeline for d2vhps1:

• d2vhps1 first appeared in SCOP 1.75
  
• d2vhps1 appears in SCOPe 2.05
  
• d2vhps1 appears in SCOPe 2.07
  
• d2vhps1 appears in the current release, SCOPe 2.08