SCOPe 2.01: Domain d2vhpp1: 2vhp P:1-81

Lineage for d2vhpp1 (2vhp P:1-81)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
   beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234

4. Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family)

5. Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)

6. Protein Ribosomal protein S16 [54567] (3 species)

7. Species Escherichia coli [TaxId:562] [160143] (26 PDB entries)
   Uniprot P0A7T3 1-82

8. Domain d2vhpp1: 2vhp P:1-81 [153160]
   Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1
   automatically matched to 2AVY P:1-82
   protein/RNA complex; complexed with mg

Details for d2vhpp1

PDB Entry: 2vhp, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)

PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2vhpp1:

Sequence; same for both SEQRES and ATOM records:

>d2vhpp1 d.27.1.1 (P:1-81) Ribosomal protein S16 {Escherichia coli [TaxId: 562]}
mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
vgqgatisdrvaalikevnka

Timeline for d2vhpp1:

• d2vhpp1 first appeared in SCOP 1.75
  
• d2vhpp1 appears in SCOPe 2.02
  
• d2vhpp1 appears in the current release, SCOPe 2.08