Lineage for d2vhpp1 (2vhp P:1-81)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857884Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 857885Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 857886Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 857887Protein Ribosomal protein S16 [54567] (3 species)
  7. 857890Species Escherichia coli [TaxId:562] [160143] (26 PDB entries)
    Uniprot P0A7T3 1-82
  8. 857916Domain d2vhpp1: 2vhp P:1-81 [153160]
    Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1
    automatically matched to 2AVY P:1-82
    complexed with mg

Details for d2vhpp1

PDB Entry: 2vhp (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)
PDB Compounds: (P:) 30S ribosomal protein S16

SCOP Domain Sequences for d2vhpp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhpp1 d.27.1.1 (P:1-81) Ribosomal protein S16 {Escherichia coli [TaxId: 562]}
mvtirlarhgakkrpfyqvvvadsrnarngrfiervgffnpiasekeegtrldldriahw
vgqgatisdrvaalikevnka

SCOP Domain Coordinates for d2vhpp1:

Click to download the PDB-style file with coordinates for d2vhpp1.
(The format of our PDB-style files is described here.)

Timeline for d2vhpp1: