SCOP 1.75: Domain d2vhpo1: 2vhp O:1-88

Lineage for d2vhpo1 (2vhp O:1-88)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
   contains additional N-terminal helix that forms a separate unit

6. Protein Ribosomal protein S15 [47065] (3 species)

7. Species Escherichia coli [TaxId:562] [158383] (10 PDB entries)
   Uniprot Q8X9M2 2-89

8. Domain d2vhpo1: 2vhp O:1-88 [153159]
   Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1
   automatically matched to 2AVY O:1-88
   complexed with mg

Details for d2vhpo1

PDB Entry: 2vhp, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)

PDB Compounds: (O:) 30S ribosomal protein S15

SCOP Domain Sequences for d2vhpo1:

Sequence; same for both SEQRES and ATOM records:

>d2vhpo1 a.16.1.2 (O:1-88) Ribosomal protein S15 {Escherichia coli [TaxId: 562]}
slsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvs
qrrklldylkrkdvarytrlierlglrr

Timeline for d2vhpo1:

• d2vhpo1 is new in SCOP 1.75
  
• d2vhpo1 appears in SCOPe 2.01
  
• d2vhpo1 appears in the current release, SCOPe 2.08