Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein Ribosomal protein S12 [50302] (2 species) |
Species Escherichia coli [TaxId:562] [159087] (25 PDB entries) Uniprot P0A7S3 1-123 |
Domain d2vhpl1: 2vhp L:1-123 [153156] Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2vhp (more details), 3.74 Å
SCOPe Domain Sequences for d2vhpl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhpl1 b.40.4.5 (L:1-123) Ribosomal protein S12 {Escherichia coli [TaxId: 562]} atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr pka
Timeline for d2vhpl1: