Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (3 families) |
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
Protein Ribosomal protein S11 [53141] (2 species) |
Species Escherichia coli [TaxId:562] [159644] (24 PDB entries) Uniprot P0A7R9 12-128 |
Domain d2vhpk1: 2vhp K:12-128 [153155] Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2vhp (more details), 3.74 Å
SCOPe Domain Sequences for d2vhpk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhpk1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]} rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv
Timeline for d2vhpk1: