Lineage for d2vhpi1 (2vhp I:3-129)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016991Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1016992Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1016993Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1017099Protein Ribosomal protein S9 [54218] (2 species)
  7. 1017100Species Escherichia coli [TaxId:562] [159907] (26 PDB entries)
    Uniprot P0A7X3 3-129
  8. 1017124Domain d2vhpi1: 2vhp I:3-129 [153153]
    Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1
    automatically matched to 2AVY I:3-129
    protein/RNA complex; complexed with mg

Details for d2vhpi1

PDB Entry: 2vhp (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)
PDB Compounds: (I:) 30S ribosomal protein S9

SCOPe Domain Sequences for d2vhpi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhpi1 d.14.1.1 (I:3-129) Ribosomal protein S9 {Escherichia coli [TaxId: 562]}
nqyygtgrrkssaarvfikpgngkivinqrsleqyfgretarmvvrqplelvdmvekldl
yitvkgggisgqagairhgitralmeydeslrselrkagfvtrdarqverkkvglrkarr
rpqfskr

SCOPe Domain Coordinates for d2vhpi1:

Click to download the PDB-style file with coordinates for d2vhpi1.
(The format of our PDB-style files is described here.)

Timeline for d2vhpi1: