Lineage for d2vhpf1 (2vhp F:1-100)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1416810Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1416811Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1416812Protein Ribosomal protein S6 [54997] (4 species)
  7. 1416815Species Escherichia coli [TaxId:562] [160317] (24 PDB entries)
    Uniprot P02358 1-100
  8. 1416839Domain d2vhpf1: 2vhp F:1-100 [153150]
    Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1
    automatically matched to 2AVY F:1-100
    protein/RNA complex; complexed with mg

Details for d2vhpf1

PDB Entry: 2vhp (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2vhpf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhpf1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]}
mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
lmnveapqevidelettfrfndavirsmvmrtkhavteas

SCOPe Domain Coordinates for d2vhpf1:

Click to download the PDB-style file with coordinates for d2vhpf1.
(The format of our PDB-style files is described here.)

Timeline for d2vhpf1: