![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) ![]() |
![]() | Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
![]() | Protein Ribosomal protein S6 [54997] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [160317] (24 PDB entries) Uniprot P02358 1-100 |
![]() | Domain d2vhpf1: 2vhp F:1-100 [153150] Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1 automatically matched to 2AVY F:1-100 complexed with mg |
PDB Entry: 2vhp (more details), 3.74 Å
SCOP Domain Sequences for d2vhpf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhpf1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]} mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv lmnveapqevidelettfrfndavirsmvmrtkhavteas
Timeline for d2vhpf1: