SCOPe 2.06: Domain d2vhoc2: 2vho C:106-206

Lineage for d2vhoc2 (2vho C:106-206)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
   alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143

4. Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family)
   automatically mapped to Pfam PF00189

5. Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)

6. Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)

7. Species Escherichia coli [TaxId:562] [160263] (24 PDB entries)
   Uniprot P0A7V3 106-206

8. Domain d2vhoc2: 2vho C:106-206 [153124]
   Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1
   protein/RNA complex; complexed with mg
   protein/RNA complex; complexed with mg

Details for d2vhoc2

PDB Entry: 2vho, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2vhoc2:

Sequence; same for both SEQRES and ATOM records:

>d2vhoc2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]}
rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte
wyregrvplhtlradidyntseahttygvigvkvwifkgei

Timeline for d2vhoc2:

• d2vhoc2 first appeared in SCOP 1.75
  
• d2vhoc2 appears in SCOPe 2.05
  
• d2vhoc2 appears in SCOPe 2.07
  
• d2vhoc2 appears in the current release, SCOPe 2.08