Lineage for d2vhmc1 (2vhm C:125-269)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946782Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 946945Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)
  6. 946946Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)
  7. 946957Species Escherichia coli [TaxId:562] [159027] (27 PDB entries)
    Uniprot P60422 125-269
  8. 946978Domain d2vhmc1: 2vhm C:125-269 [153062]
    Other proteins in same PDB: d2vhm01, d2vhm11, d2vhm31, d2vhm41, d2vhmc2, d2vhmd1, d2vhme1, d2vhmf1, d2vhmg1, d2vhmg2, d2vhmh1, d2vhmh2, d2vhmi1, d2vhmi2, d2vhmj1, d2vhmk1, d2vhml1, d2vhmm1, d2vhmn1, d2vhmo1, d2vhmp1, d2vhmq1, d2vhmr1, d2vhms1, d2vhmt1, d2vhmu1, d2vhmv1, d2vhmw1, d2vhmx1, d2vhmy1, d2vhmz1
    automatically matched to 2AW4 C:125-269
    protein/RNA complex; complexed with mg

Details for d2vhmc1

PDB Entry: 2vhm (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome
PDB Compounds: (C:) 50S ribosomal protein L2

SCOPe Domain Sequences for d2vhmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhmc1 b.34.5.3 (C:125-269) C-terminal domain of ribosomal protein L2 {Escherichia coli [TaxId: 562]}
pgntlpmrnipvgstvhnvemkpgkggqlarsagtyvqivardgayvtlrlrsgemrkve
adcratlgevgnaehmlrvlgkagaarwrgvrptvrgtamnpvdhphgggegrnfgkhpv
tpwgvqtkgkktrsnkrtdkfivrr

SCOPe Domain Coordinates for d2vhmc1:

Click to download the PDB-style file with coordinates for d2vhmc1.
(The format of our PDB-style files is described here.)

Timeline for d2vhmc1: