Lineage for d2vhdb2 (2vhd B:165-323)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981360Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
    duplication: contains two cytochrome c-type domains
  6. 1981361Protein Di-heme cytochrome c peroxidase [46686] (3 species)
  7. 1981371Species Pseudomonas aeruginosa [TaxId:287] [46687] (2 PDB entries)
  8. 1981375Domain d2vhdb2: 2vhd B:165-323 [153053]
    automated match to d1eb7a2
    complexed with ca, hec

Details for d2vhdb2

PDB Entry: 2vhd (more details), 2.3 Å

PDB Description: crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa - mixed valence form
PDB Compounds: (B:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d2vhdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhdb2 a.3.1.5 (B:165-323) Di-heme cytochrome c peroxidase {Pseudomonas aeruginosa [TaxId: 287]}
tpdspfdlylkgddkaldaqqkkglkafmdsgcsachnginlggqayfpfglvkkpdasv
lpsgdkgrfavtktqsdeyvfraaplrnvaltapyfhsgqvwelkdavaimgnaqlgkql
apddvenivaflhslsgkqprveypllpastettprpae

SCOPe Domain Coordinates for d2vhdb2:

Click to download the PDB-style file with coordinates for d2vhdb2.
(The format of our PDB-style files is described here.)

Timeline for d2vhdb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vhdb1