SCOPe 2.07: Domain d2vhdb1: 2vhd B:1-164

Lineage for d2vhdb1 (2vhd B:1-164)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
   duplication: contains two cytochrome c-type domains

6. Protein Di-heme cytochrome c peroxidase [46686] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [46687] (2 PDB entries)

8. Domain d2vhdb1: 2vhd B:1-164 [153052]
   automated match to d1eb7a1
   complexed with ca, hec

Details for d2vhdb1

PDB Entry: 2vhd, 2.3 Å

PDB Description: crystal structure of the di-haem cytochrome c peroxidase from pseudomonas aeruginosa - mixed valence form

PDB Compounds: (B:) cytochrome c551 peroxidase

SCOPe Domain Sequences for d2vhdb1:

Sequence; same for both SEQRES and ATOM records:

>d2vhdb1 a.3.1.5 (B:1-164) Di-heme cytochrome c peroxidase {Pseudomonas aeruginosa [TaxId: 287]}
dalhdqasalfkpipeqvtelrgqpiseqqrelgkklffdprlsrshvlscntchnvgtg
gadnvptsvghgwqkgprnsptvfnavfnaaqfwdgrakdlgeqakgpiqnsvemhstpq
lveqtlgsipeyvdafrkafpkagkpvsfdnmalaieayeatlv

Timeline for d2vhdb1:

• d2vhdb1 first appeared in SCOP 1.75
  
• d2vhdb1 appears in SCOPe 2.06
  
• d2vhdb1 appears in the current release, SCOPe 2.08