Lineage for d2vh8d1 (2vh8 D:82-288)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 794771Family b.29.1.4: Laminin G-like module [49944] (6 proteins)
  6. 794797Protein Ligand-binding domain of neurexin 1beta [49949] (2 species)
  7. 794801Species Rat (Rattus norvegicus) [TaxId:10116] [49950] (4 PDB entries)
  8. 794824Domain d2vh8d1: 2vh8 D:82-288 [153049]
    automatically matched to d1c4rg_
    complexed with ca

Details for d2vh8d1

PDB Entry: 2vh8 (more details), 3.9 Å

PDB Description: crystal structure of synaptic protein neuroligin 4 in complex with neurexin beta 1.
PDB Compounds: (D:) Neurexin-1-beta

SCOP Domain Sequences for d2vh8d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vh8d1 b.29.1.4 (D:82-288) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]}
hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlv

SCOP Domain Coordinates for d2vh8d1:

Click to download the PDB-style file with coordinates for d2vh8d1.
(The format of our PDB-style files is described here.)

Timeline for d2vh8d1:

  • d2vh8d1 is new in SCOP 1.75
  • d2vh8d1 became obsolete in SCOPe 2.01