SCOPe 2.08: Domain d2vh5r_: 2vh5 R:

Lineage for d2vh5r_ (2vh5 R:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d2vh5r_: 2vh5 R: [153047]
   Other proteins in same PDB: d2vh5h_, d2vh5l_
   automated match to d1aa9a_
   complexed with gtp, mg, zn; mutant

Details for d2vh5r_

PDB Entry: 2vh5, 2.7 Å

PDB Description: crystal structure of hras(g12v) - anti-ras fv (disulfide free mutant) complex

PDB Compounds: (R:) gtpase hras

SCOPe Domain Sequences for d2vh5r_:

Sequence; same for both SEQRES and ATOM records:

>d2vh5r_ c.37.1.8 (R:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d2vh5r_:

• d2vh5r_ first appeared in SCOP 1.75, called d2vh5r1
  
• d2vh5r_ appears in SCOPe 2.07