| Class b: All beta proteins [48724] (174 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.4: Dom34/Pelota N-terminal domain-like [159065] (1 family) ![]() |
| Family b.38.4.1: Dom34/Pelota N-terminal domain-like [159066] (2 proteins) Warning: Pfam incorrectly assigns this domain to the same family as the structurally unrelated N-terminal domain of eRF1 (Pfam PF03463) |
| Protein Dom34 [159069] (1 species) |
| Species Saccharomyces cerevisiae [TaxId:4932] [159070] (2 PDB entries) Uniprot P33309 1-135 |
| Domain d2vgnb1: 2vgn B:1-135 [153043] Other proteins in same PDB: d2vgna2, d2vgna3, d2vgnb2, d2vgnb3 automatically matched to 2VGM A:1-135 complexed with gol, po4 |
PDB Entry: 2vgn (more details), 2.5 Å
SCOP Domain Sequences for d2vgnb1:
Sequence, based on SEQRES records: (download)
>d2vgnb1 b.38.4.1 (B:1-135) Dom34 {Saccharomyces cerevisiae [TaxId: 4932]}
mkvislkkdsfnkggavitllpedkedlftvyqivdkddelifkkkftskldeagkkkst
dlvklkikvisedfdmkdeylkykgvtvtdesgasnvdipvgkylsftldyvypftiikq
nfnkfmqkllneacn
>d2vgnb1 b.38.4.1 (B:1-135) Dom34 {Saccharomyces cerevisiae [TaxId: 4932]}
mkvislkkdkggavitllpedkedlftvyqivdkddelifkkkftdlvklkikvisedfd
mkdeylkykgvtvtdesgasnvdipvgkylsftldyvypftiikqnfnkfmqkllneacn
Timeline for d2vgnb1: