Lineage for d2vgma3 (2vgm A:278-381)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566728Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2566837Family d.79.3.2: ERF1/Dom34 C-terminal domain-like [55323] (3 proteins)
    automatically mapped to Pfam PF03465
  6. 2566846Protein Dom34 [160509] (1 species)
  7. 2566847Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [160510] (2 PDB entries)
    Uniprot P33309 278-381
  8. 2566850Domain d2vgma3: 2vgm A:278-381 [153039]
    Other proteins in same PDB: d2vgma1, d2vgma2

Details for d2vgma3

PDB Entry: 2vgm (more details), 2.6 Å

PDB Description: structure of s. cerevisiae dom34, a translation termination-like factor involved in rna quality control pathways and interacting with hbs1 (unlabeled protein)
PDB Compounds: (A:) dom34

SCOPe Domain Sequences for d2vgma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vgma3 d.79.3.2 (A:278-381) Dom34 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
skeimvmdefllhlnkdddkawygekevvkaaeygaisyllltdkvlhsdniaqreeylk
lmdsvesnggkalvlstlhslgeeldqltgiacilkyplpdlde

SCOPe Domain Coordinates for d2vgma3:

Click to download the PDB-style file with coordinates for d2vgma3.
(The format of our PDB-style files is described here.)

Timeline for d2vgma3: