SCOP 1.75: Domain d2ve9a1: 2ve9 A:746-808

Lineage for d2ve9a1 (2ve9 A:746-808)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.67: FtsK C-terminal domain-like [140295] (1 protein)
   PfamB PB000224

6. Protein DNA translocase FtsK [140296] (2 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [140298] (3 PDB entries)
   Uniprot Q9I0M3 742-811

8. Domain d2ve9a1: 2ve9 A:746-808 [153016]
   automatically matched to d2j5oa1
   complexed with mg

Details for d2ve9a1

PDB Entry: 2ve9, 1.9 Å

PDB Description: xray structure of kops bound gamma domain of ftsk (p. aeruginosa)

PDB Compounds: (A:) DNA translocase ftsk

SCOP Domain Sequences for d2ve9a1:

Sequence; same for both SEQRES and ATOM records:

>d2ve9a1 a.4.5.67 (A:746-808) DNA translocase FtsK {Pseudomonas aeruginosa [TaxId: 287]}
ddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsrevia
pap

Timeline for d2ve9a1:

• d2ve9a1 is new in SCOP 1.75
  
• d2ve9a1 is called d2ve9a_ in SCOPe 2.01
  
• d2ve9a1 appears in the current release, SCOPe 2.08, called d2ve9a_