Lineage for d2ve8e1 (2ve8 E:745-810)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762960Family a.4.5.67: FtsK C-terminal domain-like [140295] (1 protein)
    PfamB PB000224
  6. 762961Protein DNA translocase FtsK [140296] (2 species)
  7. 762964Species Pseudomonas aeruginosa [TaxId:287] [140298] (3 PDB entries)
    Uniprot Q9I0M3 742-811
  8. 762969Domain d2ve8e1: 2ve8 E:745-810 [153012]
    automatically matched to d2j5oa1

Details for d2ve8e1

PDB Entry: 2ve8 (more details), 1.4 Å

PDB Description: Xray structure of FtsK gamma domain (P. aeruginosa)
PDB Compounds: (E:) DNA translocase ftsk

SCOP Domain Sequences for d2ve8e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ve8e1 a.4.5.67 (E:745-810) DNA translocase FtsK {Pseudomonas aeruginosa [TaxId: 287]}
eddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsrevi
apapvr

SCOP Domain Coordinates for d2ve8e1:

Click to download the PDB-style file with coordinates for d2ve8e1.
(The format of our PDB-style files is described here.)

Timeline for d2ve8e1: