Lineage for d2ve8b_ (2ve8 B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 907188Family a.4.5.67: FtsK C-terminal domain-like [140295] (2 proteins)
    PfamB PB000224
  6. 907194Protein automated matches [190361] (1 species)
    not a true protein
  7. 907195Species Pseudomonas aeruginosa [TaxId:287] [187192] (2 PDB entries)
  8. 907197Domain d2ve8b_: 2ve8 B: [153009]
    automated match to d2j5oa1

Details for d2ve8b_

PDB Entry: 2ve8 (more details), 1.4 Å

PDB Description: Xray structure of FtsK gamma domain (P. aeruginosa)
PDB Compounds: (B:) DNA translocase ftsk

SCOPe Domain Sequences for d2ve8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ve8b_ a.4.5.67 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsrevi
apapv

SCOPe Domain Coordinates for d2ve8b_:

Click to download the PDB-style file with coordinates for d2ve8b_.
(The format of our PDB-style files is described here.)

Timeline for d2ve8b_: