Lineage for d2ve6g1 (2ve6 G:182-274)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784408Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 784629Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
    Uniprot P01901 22-299
  8. 784711Domain d2ve6g1: 2ve6 G:182-274 [153004]
    Other proteins in same PDB: d2ve6a2, d2ve6d2, d2ve6g2, d2ve6j2
    automatically matched to d1ddha1
    complexed with prq

Details for d2ve6g1

PDB Entry: 2ve6 (more details), 2.65 Å

PDB Description: crystal structure of a murine mhc class i h2-db molecule in complex with a photocleavable peptide
PDB Compounds: (G:) h-2 class I histocompatibility antigen d-b alpha chain

SCOP Domain Sequences for d2ve6g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ve6g1 b.1.1.2 (G:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

SCOP Domain Coordinates for d2ve6g1:

Click to download the PDB-style file with coordinates for d2ve6g1.
(The format of our PDB-style files is described here.)

Timeline for d2ve6g1: