Lineage for d2vdbb_ (2vdb B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986263Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1986264Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 1986390Family a.8.1.2: GA module, an albumin-binding domain [47001] (4 proteins)
    Pfam PF01468; also includes FIVAR module, Pfam PF07554
  6. 1986410Protein automated matches [190362] (1 species)
    not a true protein
  7. 1986411Species Peptostreptococcus magnus [TaxId:1260] [187194] (2 PDB entries)
  8. 1986414Domain d2vdbb_: 2vdb B: [152972]
    Other proteins in same PDB: d2vdba1, d2vdba2, d2vdba3
    automated match to d1gaba_
    complexed with dka, nps

Details for d2vdbb_

PDB Entry: 2vdb (more details), 2.52 Å

PDB Description: structure of human serum albumin with s-naproxen and the ga module
PDB Compounds: (B:) peptostreptococcal albumin-binding protein

SCOPe Domain Sequences for d2vdbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdbb_ a.8.1.2 (B:) automated matches {Peptostreptococcus magnus [TaxId: 1260]}
hmtidqwllknakedaiaelkkagitsdfyfnainkaktveevnalkneilkaha

SCOPe Domain Coordinates for d2vdbb_:

Click to download the PDB-style file with coordinates for d2vdbb_.
(The format of our PDB-style files is described here.)

Timeline for d2vdbb_: