SCOP 1.75: Domain d2vdbb1: 2vdb B:1-53

Lineage for d2vdbb1 (2vdb B:1-53)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families)

5. Family a.8.1.2: GA module, an albumin-binding domain [47001] (3 proteins)
   Pfam PF01468; also includes FIVAR module, Pfam PF07554

6. Protein PAB [47002] (1 species)

7. Species Peptostreptococcus magnus [TaxId:1260] [47003] (5 PDB entries)
   Uniprot Q51911 213-265

8. Domain d2vdbb1: 2vdb B:1-53 [152972]
   Other proteins in same PDB: d2vdba1, d2vdba2
   automatically matched to d1gaba_
   complexed with dka, nps

Details for d2vdbb1

PDB Entry: 2vdb, 2.52 Å

PDB Description: structure of human serum albumin with s-naproxen and the ga module

PDB Compounds: (B:) peptostreptococcal albumin-binding protein

SCOP Domain Sequences for d2vdbb1:

Sequence; same for both SEQRES and ATOM records:

>d2vdbb1 a.8.1.2 (B:1-53) PAB {Peptostreptococcus magnus [TaxId: 1260]}
tidqwllknakedaiaelkkagitsdfyfnainkaktveevnalkneilkaha

Timeline for d2vdbb1:

• d2vdbb1 is new in SCOP 1.75
  
• d2vdbb1 is called d2vdbb_ in SCOPe 2.01
  
• d2vdbb1 appears in the current release, SCOPe 2.08, called d2vdbb_