SCOPe 2.08: Domain d2vdbb_: 2vdb B:

Lineage for d2vdbb_ (2vdb B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families)

5. Family a.8.1.2: GA module, an albumin-binding domain [47001] (4 proteins)
   Pfam PF01468; also includes FIVAR module, Pfam PF07554

6. Protein automated matches [190362] (1 species)
   not a true protein

7. Species Peptostreptococcus magnus [TaxId:1260] [187194] (2 PDB entries)

8. Domain d2vdbb_: 2vdb B: [152972]
   Other proteins in same PDB: d2vdba1, d2vdba2, d2vdba3
   automated match to d1gaba_
   complexed with dka, nps

Details for d2vdbb_

PDB Entry: 2vdb, 2.52 Å

PDB Description: structure of human serum albumin with s-naproxen and the ga module

PDB Compounds: (B:) peptostreptococcal albumin-binding protein

SCOPe Domain Sequences for d2vdbb_:

Sequence; same for both SEQRES and ATOM records:

>d2vdbb_ a.8.1.2 (B:) automated matches {Peptostreptococcus magnus [TaxId: 1260]}
hmtidqwllknakedaiaelkkagitsdfyfnainkaktveevnalkneilkaha

Timeline for d2vdbb_:

• d2vdbb_ first appeared in SCOP 1.75, called d2vdbb1
  
• d2vdbb_ appears in SCOPe 2.07