SCOPe 2.03: Domain d2vcqd2: 2vcq D:2-75

Lineage for d2vcqd2 (2vcq D:2-75)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class sigma GST [81362] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89705] (13 PDB entries)
   Uniprot O60760
   synonym: hematopoietic prostaglandin D synthase

8. Domain d2vcqd2: 2vcq D:2-75 [152929]
   Other proteins in same PDB: d2vcqa1, d2vcqb1, d2vcqc1, d2vcqd1
   automatically matched to d1iyha2
   complexed with d25, gsh

Details for d2vcqd2

PDB Entry: 2vcq, 1.95 Å

PDB Description: complex structure of prostaglandin d2 synthase at 1.95a.

PDB Compounds: (D:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2vcqd2:

Sequence; same for both SEQRES and ATOM records:

>d2vcqd2 c.47.1.5 (D:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

Timeline for d2vcqd2:

• d2vcqd2 first appeared in SCOP 1.75
  
• d2vcqd2 appears in SCOPe 2.02
  
• d2vcqd2 appears in SCOPe 2.04
  
• d2vcqd2 appears in the current release, SCOPe 2.08