Lineage for d2vcfx1 (2vcf X:1-250)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 773241Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 773242Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 773243Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 773244Protein Ascorbate peroxidase [48123] (3 species)
  7. 773252Species Soybean (Glycine max) [TaxId:3847] [89092] (6 PDB entries)
    Uniprot Q43758
  8. 773256Domain d2vcfx1: 2vcf X:1-250 [152916]
    automatically matched to d1oafa_
    complexed with hem, isz, na

Details for d2vcfx1

PDB Entry: 2vcf (more details), 1.8 Å

PDB Description: structure of isoniazid (inh) bound to cytosolic soybean ascorbate peroxidase
PDB Compounds: (X:) ascorbate peroxidase from soybean cytosol

SCOP Domain Sequences for d2vcfx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vcfx1 a.93.1.1 (X:1-250) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
sgksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgti
khpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgre
dkpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwt
snplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahq
klselgfada

SCOP Domain Coordinates for d2vcfx1:

Click to download the PDB-style file with coordinates for d2vcfx1.
(The format of our PDB-style files is described here.)

Timeline for d2vcfx1: