Lineage for d2vana1 (2van A:91-148)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272870Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1272871Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 1272872Protein DNA polymerase beta [81579] (2 species)
  7. 1273006Species Norway rat (Rattus norvegicus) [TaxId:10116] [81577] (20 PDB entries)
  8. 1273007Domain d2vana1: 2van A:91-148 [152826]
    Other proteins in same PDB: d2vana2
    automatically matched to d1bpba1

Details for d2vana1

PDB Entry: 2van (more details), 2.1 Å

PDB Description: nucleotidyl transfer mechanism of mismatched dntp incorporation by dna polymerase b by structural and kinetic analyses
PDB Compounds: (A:) DNA polymerse beta

SCOPe Domain Sequences for d2vana1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vana1 a.60.12.1 (A:91-148) DNA polymerase beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

SCOPe Domain Coordinates for d2vana1:

Click to download the PDB-style file with coordinates for d2vana1.
(The format of our PDB-style files is described here.)

Timeline for d2vana1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vana2