SCOPe 2.08: Domain d2vana1: 2van A:91-148

Lineage for d2vana1 (2van A:91-148)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.0: automated matches [254215] (1 protein)
   not a true family

6. Protein automated matches [254483] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [255607] (2 PDB entries)

8. Domain d2vana1: 2van A:91-148 [152826]
   Other proteins in same PDB: d2vana2
   automated match to d2vana1

Details for d2vana1

PDB Entry: 2van, 2.1 Å

PDB Description: nucleotidyl transfer mechanism of mismatched dntp incorporation by dna polymerase b by structural and kinetic analyses

PDB Compounds: (A:) DNA polymerse beta

SCOPe Domain Sequences for d2vana1:

Sequence; same for both SEQRES and ATOM records:

>d2vana1 a.60.12.0 (A:91-148) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

Timeline for d2vana1:

• d2vana1 first appeared in SCOP 1.75
  
• d2vana1 appears in SCOPe 2.07