SCOP 1.75: Domain d2va9b1: 2va9 B:4-535

Lineage for d2va9b1 (2va9 B:4-535)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (41 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.1: Acetylcholinesterase-like [53475] (5 proteins)

6. Protein Acetylcholinesterase [53476] (5 species)

7. Species Pacific electric ray (Torpedo californica) [TaxId:7787] [53477] (68 PDB entries)
   Uniprot P04058 25-556

8. Domain d2va9b1: 2va9 B:4-535 [152825]
   automatically matched to d1evea_
   complexed with nag

Details for d2va9b1

PDB Entry: 2va9, 2.4 Å

PDB Description: structure of native tcache after a 9 seconds annealing to room temperature during the first 5 seconds of which laser irradiation at 266nm took place

PDB Compounds: (B:) acetylcholinesterase

SCOP Domain Sequences for d2va9b1:

Sequence; same for both SEQRES and ATOM records:

>d2va9b1 c.69.1.1 (B:4-535) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]}
sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat

Timeline for d2va9b1:

• d2va9b1 is new in SCOP 1.75
  
• d2va9b1 is called d2va9b_ in SCOPe 2.01
  
• d2va9b1 appears in the current release, SCOPe 2.08, called d2va9b_