Lineage for d2v9jb1 (2v9j B:190-272)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882879Fold d.353: AMPKBI-like [160218] (1 superfamily)
    comprises 3 short helices and 3-stranded meander beta-sheet; makes extensive intermolecular interactions
  4. 882880Superfamily d.353.1: AMPKBI-like [160219] (1 family) (S)
  5. 882881Family d.353.1.1: AMPKBI-like [160220] (3 proteins)
    Pfam PF04739; 5'-AMP-activated protein kinase, beta subunit, complex-interacting region
  6. 882882Protein 5'-AMP-activated protein kinase subunit beta-2 [160223] (1 species)
  7. 882883Species Human (Homo sapiens) [TaxId:9606] [160224] (3 PDB entries)
    Uniprot O43741 190-272
  8. 882886Domain d2v9jb1: 2v9j B:190-272 [152806]
    Other proteins in same PDB: d2v9ja1, d2v9je1, d2v9je2
    automatically matched to 2V8Q B:190-272
    complexed with amp, atp, mg

Details for d2v9jb1

PDB Entry: 2v9j (more details), 2.53 Å

PDB Description: crystal structure of the regulatory fragment of mammalian ampk in complexes with mg.atp-amp
PDB Compounds: (B:) 5'-amp-activated protein kinase subunit beta-2

SCOP Domain Sequences for d2v9jb1:

Sequence, based on SEQRES records: (download)

>d2v9jb1 d.353.1.1 (B:190-272) 5'-AMP-activated protein kinase subunit beta-2 {Human (Homo sapiens) [TaxId: 9606]}
gqemyafrseerfksppilpphllqvilnkdtniscdpallpepnhvmlnhlyalsikds
vmvlsathrykkkyvttllykpi

Sequence, based on observed residues (ATOM records): (download)

>d2v9jb1 d.353.1.1 (B:190-272) 5'-AMP-activated protein kinase subunit beta-2 {Human (Homo sapiens) [TaxId: 9606]}
gqemyafrseerfksppilpphllqvilnkdtnpnhvmlnhlyalsikdsvmvlsathry
kkkyvttllykpi

SCOP Domain Coordinates for d2v9jb1:

Click to download the PDB-style file with coordinates for d2v9jb1.
(The format of our PDB-style files is described here.)

Timeline for d2v9jb1: