SCOP 1.75: Domain d2v9ja1: 2v9j A:396-548

Lineage for d2v9ja1 (2v9j A:396-548)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.6: KA1-like [103243] (2 families)
   contains a single copy of this fold

5. Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (3 proteins)
   PfamB PB166430

6. Protein 5'-AMP-activated protein kinase catalytic subunit alpha-1, AMPK1 [160728] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [160729] (3 PDB entries)
   Uniprot P54645 396-548

8. Domain d2v9ja1: 2v9j A:396-548 [152805]
   Other proteins in same PDB: d2v9jb1, d2v9je1, d2v9je2
   automatically matched to 2V8Q A:396-548
   complexed with amp, atp, mg

Details for d2v9ja1

PDB Entry: 2v9j, 2.53 Å

PDB Description: crystal structure of the regulatory fragment of mammalian ampk in complexes with mg.atp-amp

PDB Compounds: (A:) 5'-amp-activated protein kinase catalytic subunit alpha-1

SCOP Domain Sequences for d2v9ja1:

Sequence, based on SEQRES records:

>d2v9ja1 d.129.6.2 (A:396-548) 5'-AMP-activated protein kinase catalytic subunit alpha-1, AMPK1 {Rat (Rattus norvegicus) [TaxId: 10116]}
whlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyqvd
srtylldfrsiddeiteaksgtatpqrsgsisnyrscqrsdsdaeaqgkpsevsltssvt
sldsspvdvaprpgshtieffemcanlikilaq

Sequence, based on observed residues (ATOM records):

>d2v9ja1 d.129.6.2 (A:396-548) 5'-AMP-activated protein kinase catalytic subunit alpha-1, AMPK1 {Rat (Rattus norvegicus) [TaxId: 10116]}
whlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqlyqvd
srtylldfrsiddevaprpgshtieffemcanlikilaq

Timeline for d2v9ja1:

• d2v9ja1 is new in SCOP 1.75
  
• d2v9ja1 is called d2v9ja_ in SCOPe 2.01
  
• d2v9ja1 appears in the current release, SCOPe 2.08, called d2v9ja_