SCOPe 2.01: Domain d2v92a_: 2v92 A:

Lineage for d2v92a_ (2v92 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.6: KA1-like [103243] (2 families)
   contains a single copy of this fold

5. Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins)
   PfamB PB166430

6. Protein automated matches [190788] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188043] (5 PDB entries)

8. Domain d2v92a_: 2v92 A: [152791]
   Other proteins in same PDB: d2v92b_, d2v92e1, d2v92e2
   automated match to d2v8qa1
   complexed with amp, atp

Details for d2v92a_

PDB Entry: 2v92, 2.4 Å

PDB Description: crystal structure of the regulatory fragment of mammalian ampk in complexes with atp-amp

PDB Compounds: (A:) 5'-amp-activated protein kinase catalytic subunit alpha-1

SCOPe Domain Sequences for d2v92a_:

Sequence, based on SEQRES records:

>d2v92a_ d.129.6.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
smawhlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqly
qvdsrtylldfrsiddeiteaksgtatpqrsgsisnyrscqrsdsdaeaqgkpsevslts
svtsldsspvdvaprpgshtieffemcanlikilaq

Sequence, based on observed residues (ATOM records):

>d2v92a_ d.129.6.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
smawhlgirsqsrpndimaevcraikqldyewkvvnpyylrvrrknpvtstfskmslqly
qvdsrtylldfrsiddevaprpgshtieffemcanlikilaq

Timeline for d2v92a_:

• d2v92a_ first appeared in SCOP 1.75, called d2v92a1
  
• d2v92a_ appears in SCOPe 2.02
  
• d2v92a_ appears in the current release, SCOPe 2.08