Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein 5'-AMP-activated protein kinase subunit gamma-1, AMPKg [160176] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [160177] (15 PDB entries) Uniprot P80385 182-326! Uniprot P80385 23-181 |
Domain d2v8qe1: 2v8q E:182-326 [152783] Other proteins in same PDB: d2v8qa1, d2v8qb1 complexed with amp |
PDB Entry: 2v8q (more details), 2.1 Å
SCOPe Domain Sequences for d2v8qe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Norway rat (Rattus norvegicus) [TaxId: 10116]} fpkpefmsksleelqigtyaniamvrtttpvyvalgifvqhrvsalpvvdekgrvvdiys kfdvinlaaektynnldvsvtkalqhrshyfegvlkcylhetleaiinrlveaevhrlvv vdehdvvkgivslsdilqalvltgg
Timeline for d2v8qe1: