SCOPe 2.03: Domain d1c7da1: 1c7d A:1-142

Lineage for d1c7da1 (1c7d A:1-142)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (23 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (213 PDB entries)
   Uniprot P69905 P01922 P01934 P01935

8. Domain d1c7da1: 1c7d A:1-142 [15278]
   Other proteins in same PDB: d1c7db_, d1c7dd_
   recombinant hemoglobin rhb1.2
   complexed with hem

Details for d1c7da1

PDB Entry: 1c7d, 1.8 Å

PDB Description: deoxy rhb1.2 (recombinant hemoglobin)

PDB Compounds: (A:) protein (deoxyhemoglobin (alpha chain))

SCOPe Domain Sequences for d1c7da1:

Sequence; same for both SEQRES and ATOM records:

>d1c7da1 a.1.1.2 (A:1-142) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyrg

Timeline for d1c7da1:

• d1c7da1 first appeared (with stable ids) in SCOP 1.55
  
• d1c7da1 appears in SCOPe 2.02
  
• d1c7da1 appears in SCOPe 2.04
  
• d1c7da1 appears in the current release, SCOPe 2.08