Lineage for d1a3oc_ (1a3o C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 94Protein Hemoglobin, alpha-chain [46486] (13 species)
  7. 136Species Human (Homo sapiens) [TaxId:9606] [46487] (73 PDB entries)
  8. 176Domain d1a3oc_: 1a3o C: [15275]
    Other proteins in same PDB: d1a3ob_, d1a3od_

Details for d1a3oc_

PDB Entry: 1a3o (more details), 1.8 Å

PDB Description: artificial mutant (alpha y42h) of deoxy hemoglobin

SCOP Domain Sequences for d1a3oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a3oc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens)}
vlspadktnvkaawgkvgahageygaealermflsfpttkthfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

SCOP Domain Coordinates for d1a3oc_:

Click to download the PDB-style file with coordinates for d1a3oc_.
(The format of our PDB-style files is described here.)

Timeline for d1a3oc_: