Lineage for d2v7qj1 (2v7q J:8-40)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 896123Fold h.4: Antiparallel coiled-coil [58086] (17 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 896185Superfamily h.4.8: F1 ATPase inhibitor, IF1, C-terminal domain [64602] (1 family) (S)
  5. 896186Family h.4.8.1: F1 ATPase inhibitor, IF1, C-terminal domain [64603] (1 protein)
  6. 896187Protein F1 ATPase inhibitor, IF1, C-terminal domain [64604] (1 species)
    antiparallel right-handed coiled-coil
  7. 896188Species Cow (Bos taurus) [TaxId:9913] [64605] (4 PDB entries)
  8. 896189Domain d2v7qj1: 2v7q J:8-40 [152736]
    Other proteins in same PDB: d2v7qg1, d2v7qh1, d2v7qh2, d2v7qi1
    automatically matched to d1ohhh_
    complexed with adp, atp, mg, po4

Details for d2v7qj1

PDB Entry: 2v7q (more details), 2.1 Å

PDB Description: the structure of f1-atpase inhibited by i1-60his, a monomeric form of the inhibitor protein, if1.
PDB Compounds: (J:) ATPase inhibitor

SCOP Domain Sequences for d2v7qj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v7qj1 h.4.8.1 (J:8-40) F1 ATPase inhibitor, IF1, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
vrssagavrdaggafgkreqaeeeryfrarake

SCOP Domain Coordinates for d2v7qj1:

Click to download the PDB-style file with coordinates for d2v7qj1.
(The format of our PDB-style files is described here.)

Timeline for d2v7qj1: