SCOP 1.75: Domain d2v7ng2: 2v7n G:149-252

Lineage for d2v7ng2 (2v7n G:149-252)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)

7. Species Escherichia coli [TaxId:562] [158872] (3 PDB entries)

8. Domain d2v7ng2: 2v7n G:149-252 [152731]
   Other proteins in same PDB: d2v7na1, d2v7nc1, d2v7ne1, d2v7ng1
   automatically matched to d1rhha2

Details for d2v7ng2

PDB Entry: 2v7n, 1.92 Å

PDB Description: unusual twinning in crystals of the cits binding antibody fab fragment f3p4

PDB Compounds: (G:) immunoglobulin light chain

SCOP Domain Sequences for d2v7ng2:

Sequence; same for both SEQRES and ATOM records:

>d2v7ng2 b.1.1.2 (G:149-252) Immunoglobulin light chain kappa constant domain, CL-kappa {Escherichia coli [TaxId: 562]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d2v7ng2:

• d2v7ng2 is new in SCOP 1.75
  
• d2v7ng2 appears in SCOPe 2.01
  
• d2v7ng2 appears in the current release, SCOPe 2.08