SCOPe 2.04: Domain d2v7nc2: 2v7n C:149-252

Lineage for d2v7nc2 (2v7n C:149-252)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

7. Species Synthetic construct [TaxId:32630] [158871] (1 PDB entry)

8. Domain d2v7nc2: 2v7n C:149-252 [152727]
   Other proteins in same PDB: d2v7na1, d2v7nc1, d2v7ne1, d2v7ng1
   automatically matched to d1rhha2

Details for d2v7nc2

PDB Entry: 2v7n, 1.92 Å

PDB Description: unusual twinning in crystals of the cits binding antibody fab fragment f3p4

PDB Compounds: (C:) immunoglobulin light chain

SCOPe Domain Sequences for d2v7nc2:

Sequence; same for both SEQRES and ATOM records:

>d2v7nc2 b.1.1.2 (C:149-252) Immunoglobulin light chain kappa constant domain, CL-kappa {Synthetic construct [TaxId: 32630]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d2v7nc2:

• d2v7nc2 first appeared in SCOP 1.75
  
• d2v7nc2 appears in SCOPe 2.03
  
• d2v7nc2 appears in SCOPe 2.05
  
• d2v7nc2 appears in the current release, SCOPe 2.08