Lineage for d2v7db1 (2v7d B:1-229)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775740Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
  5. 775741Family a.118.7.1: 14-3-3 protein [48446] (4 proteins)
  6. 775757Protein zeta isoform [48449] (2 species)
  7. 775758Species Cow (Bos taurus) [TaxId:9913] [48450] (5 PDB entries)
  8. 775762Domain d2v7db1: 2v7d B:1-229 [152718]
    automatically matched to d1qjba_

Details for d2v7db1

PDB Entry: 2v7d (more details), 2.5 Å

PDB Description: 14-3-3 protein zeta in complex with thr758 phosphorylated integrin beta2 peptide
PDB Compounds: (B:) 14-3-3 protein zeta/delta

SCOP Domain Sequences for d2v7db1:

Sequence, based on SEQRES records: (download)

>d2v7db1 a.118.7.1 (B:1-229) zeta isoform {Cow (Bos taurus) [TaxId: 9913]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwt

Sequence, based on observed residues (ATOM records): (download)

>d2v7db1 a.118.7.1 (B:1-229) zeta isoform {Cow (Bos taurus) [TaxId: 9913]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqkteekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkmk
gdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyeil
nspekacslaktafdeaiaeldtlesykdstlimqllrdnltlwt

SCOP Domain Coordinates for d2v7db1:

Click to download the PDB-style file with coordinates for d2v7db1.
(The format of our PDB-style files is described here.)

Timeline for d2v7db1: