SCOPe 2.03: Domain d2v6ap_: 2v6a P:

Lineage for d2v6ap_ (2v6a P:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)

6. Protein automated matches [190066] (5 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (7 PDB entries)

8. Domain d2v6ap_: 2v6a P: [152715]
   Other proteins in same PDB: d2v6aa1, d2v6aa2, d2v6ab1, d2v6ab2, d2v6ac1, d2v6ac2, d2v6ad1, d2v6ad2, d2v6ae1, d2v6ae2, d2v6af1, d2v6af2, d2v6ag1, d2v6ag2, d2v6ah1, d2v6ah2
   automated match to d1ir21_
   complexed with cap, edo, mg; mutant

Details for d2v6ap_

PDB Entry: 2v6a, 1.5 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with large-subunit mutations v331a, g344s

PDB Compounds: (P:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d2v6ap_:

Sequence; same for both SEQRES and ATOM records:

>d2v6ap_ d.73.1.1 (P:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpktardfqpankrsv

Timeline for d2v6ap_:

• d2v6ap_ first appeared in SCOP 1.75, called d2v6ap1
  
• d2v6ap_ appears in SCOPe 2.02
  
• d2v6ap_ appears in SCOPe 2.04
  
• d2v6ap_ appears in the current release, SCOPe 2.08