Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (11 PDB entries) |
Domain d2v68h2: 2v68 H:10-149 [152659] Other proteins in same PDB: d2v68a1, d2v68b1, d2v68c1, d2v68d1, d2v68e1, d2v68f1, d2v68g1, d2v68h1, d2v68i1, d2v68j1, d2v68k1, d2v68l1, d2v68m1, d2v68n1, d2v68o1, d2v68p1 automatically matched to d1gk8a2 complexed with cap, edo, mg, mme; mutant |
PDB Entry: 2v68 (more details), 2.3 Å
SCOP Domain Sequences for d2v68h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v68h2 d.58.9.1 (H:10-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]} gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka lralrledlrippayvktfv
Timeline for d2v68h2: