Lineage for d2v68e1 (2v68 E:150-475)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 973964Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 973965Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 973966Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 973990Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69403] (11 PDB entries)
  8. 974047Domain d2v68e1: 2v68 E:150-475 [152652]
    Other proteins in same PDB: d2v68a2, d2v68b2, d2v68c2, d2v68d2, d2v68e2, d2v68f2, d2v68g2, d2v68h2, d2v68i_, d2v68j_, d2v68k_, d2v68l_, d2v68m_, d2v68n_, d2v68o_, d2v68p_
    automatically matched to d1gk8a1
    complexed with cap, edo, mg; mutant

Details for d2v68e1

PDB Entry: 2v68 (more details), 2.3 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with large- subunit mutations v331a, t342i
PDB Compounds: (E:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2v68e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v68e1 c.1.14.1 (E:150-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gpphgiqverdklnkygrgllgctikpklglsaknygravyeclrggldftkddenvnsq
pfmrwrdrflfvaeaiykaqaetgevkghylnatagtceemmkravcakelgvpiimhdy
ltggftantslaiycrdnglllhihramhavidrqrnhgihfrvlakalrmsggdhlhsg
tavgklegerevilgfvdlmrddyvekdrsrgiyftqdwcsmpgvmpvasggihvwhmpa
lveifgddaclqfgggtlghpwgnapgaaanrvaleactqarnegrdlareggdvirsac
kwspelaaacevwkeikfefdtidkl

SCOPe Domain Coordinates for d2v68e1:

Click to download the PDB-style file with coordinates for d2v68e1.
(The format of our PDB-style files is described here.)

Timeline for d2v68e1: