![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) ![]() C-terminal domain is beta/alpha barrel |
![]() | Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
![]() | Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
![]() | Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (11 PDB entries) |
![]() | Domain d2v67f2: 2v67 F:10-149 [152631] Other proteins in same PDB: d2v67a1, d2v67b1, d2v67c1, d2v67d1, d2v67e1, d2v67f1, d2v67g1, d2v67h1, d2v67i1, d2v67j1, d2v67k1, d2v67l1, d2v67m1, d2v67n1, d2v67o1, d2v67p1 automatically matched to d1gk8a2 complexed with cap, edo, mg, mme; mutant |
PDB Entry: 2v67 (more details), 2 Å
SCOP Domain Sequences for d2v67f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v67f2 d.58.9.1 (F:10-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]} gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka lralrledlrippayvktfv
Timeline for d2v67f2: