Lineage for d2v67c2 (2v67 C:10-149)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862528Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 862529Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 862530Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 862555Species Chlamydomonas reinhardtii [TaxId:3055] [69730] (11 PDB entries)
  8. 862594Domain d2v67c2: 2v67 C:10-149 [152625]
    Other proteins in same PDB: d2v67a1, d2v67b1, d2v67c1, d2v67d1, d2v67e1, d2v67f1, d2v67g1, d2v67h1, d2v67i1, d2v67j1, d2v67k1, d2v67l1, d2v67m1, d2v67n1, d2v67o1, d2v67p1
    automatically matched to d1gk8a2
    complexed with cap, edo, mg, mme; mutant

Details for d2v67c2

PDB Entry: 2v67 (more details), 2 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit supressor mutation t342i
PDB Compounds: (C:) ribulose bisphosphate carboxylase large chain

SCOP Domain Sequences for d2v67c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v67c2 d.58.9.1 (C:10-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlamydomonas reinhardtii [TaxId: 3055]}
gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv
wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka
lralrledlrippayvktfv

SCOP Domain Coordinates for d2v67c2:

Click to download the PDB-style file with coordinates for d2v67c2.
(The format of our PDB-style files is described here.)

Timeline for d2v67c2: