Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69730] (11 PDB entries) |
Domain d2v67b2: 2v67 B:10-149 [152623] Other proteins in same PDB: d2v67a1, d2v67b1, d2v67c1, d2v67d1, d2v67e1, d2v67f1, d2v67g1, d2v67h1, d2v67i_, d2v67j_, d2v67k_, d2v67l_, d2v67m_, d2v67n_, d2v67o_, d2v67p_ automatically matched to d1gk8a2 complexed with cap, edo, mg; mutant |
PDB Entry: 2v67 (more details), 2 Å
SCOPe Domain Sequences for d2v67b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v67b2 d.58.9.1 (B:10-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka lralrledlrippayvktfv
Timeline for d2v67b2: