Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) C-terminal domain is beta/alpha barrel |
Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [69730] (11 PDB entries) |
Domain d2v63d2: 2v63 D:11-149 [152600] Other proteins in same PDB: d2v63a1, d2v63b1, d2v63c1, d2v63d1, d2v63e1, d2v63f1, d2v63g1, d2v63h1, d2v63i_, d2v63j_, d2v63k_, d2v63l_, d2v63m_, d2v63n_, d2v63o_, d2v63p_ automatically matched to d1gk8a2 complexed with cap, edo, mg; mutant |
PDB Entry: 2v63 (more details), 1.8 Å
SCOPe Domain Sequences for d2v63d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v63d2 d.58.9.1 (D:11-149) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal ralrledlrippayvktfv
Timeline for d2v63d2: