Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) duplication: contains two subdomains of this fold |
Family d.58.36.2: DsrA/DsrB N-terminal-domain-like [160336] (2 proteins) Dissimilatory sulfite reductase is a heterodimer of homologous DsrA and DsrB subunits, the assembly of which is similar to the architecture of duplicated sulfite reductase CysI |
Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160337] (2 species) |
Species Desulfovibrio vulgaris [TaxId:881] [160339] (1 PDB entry) Uniprot P45574 2-437 |
Domain d2v4jd2: 2v4j D:2-167 [152564] Other proteins in same PDB: d2v4ja1, d2v4ja3, d2v4jb1, d2v4jb2, d2v4jb3, d2v4jc1, d2v4jd1, d2v4jd3, d2v4je1, d2v4je2, d2v4je3, d2v4jf_ automated match to d2v4ja2 complexed with sf4, sh0, so3, srm |
PDB Entry: 2v4j (more details), 2.1 Å
SCOPe Domain Sequences for d2v4jd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v4jd2 d.58.36.2 (D:2-167) Dissimilatory sulfite reductase subunit alpha, DsrA {Desulfovibrio vulgaris [TaxId: 881]} akhatpkldqlesgpwpsfvsdikqeaayraanpkgldyqvpvdcpedllgvlelsydeg ethwkhggivgvfgygggvigrycdqpekfpgvahfhtvrvaqpsgkyysadylrqlcdi wdlrgsgltnmhgstgdivllgtqtpqleeiffelthnlntdlggs
Timeline for d2v4jd2: