Lineage for d2v49h2 (2v49 H:83-171)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1041603Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 1041604Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 1041605Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 1041606Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 1041769Species Thermus thermophilus [TaxId:274] [160797] (11 PDB entries)
    Uniprot Q72I19 11-81! Uniprot Q72I19 82-170
  8. 1041781Domain d2v49h2: 2v49 H:83-171 [152548]
    Other proteins in same PDB: d2v4941, d2v4951, d2v4961, d2v4971, d2v49e1, d2v49f1, d2v49n1, d2v49p1, d2v49t1, d2v49u1, d2v49v1, d2v49y1, d2v49z1
    automatically matched to 2J01 H:83-171

Details for d2v49h2

PDB Entry: 2v49 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 4 of 4). This file contains the 50S subunit of Molecule 2.
PDB Compounds: (H:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2v49h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v49h2 d.141.1.1 (H:83-171) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]}
yskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrvrvsgidkqkvg
qvaanirairkpsayhekgiyyagepvrl

SCOPe Domain Coordinates for d2v49h2:

Click to download the PDB-style file with coordinates for d2v49h2.
(The format of our PDB-style files is described here.)

Timeline for d2v49h2: