Lineage for d2v48t1 (2v48 T:8-106)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1081581Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1081715Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 1081716Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 1081717Protein Ribosomal protein S20 [46994] (2 species)
  7. 1081745Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries)
    Uniprot P80380
  8. 1081775Domain d2v48t1: 2v48 T:8-106 [152538]
    Other proteins in same PDB: d2v48b1, d2v48d1, d2v48e1, d2v48f1, d2v48g1, d2v48h1, d2v48i1, d2v48j1, d2v48k1, d2v48l1, d2v48m1, d2v48n1, d2v48o1, d2v48p1, d2v48q1, d2v48r1, d2v48s1, d2v48u1, d2v48y1
    automatically matched to d1i94t_
    complexed with mg, zn

Details for d2v48t1

PDB Entry: 2v48 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 3 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 2.
PDB Compounds: (T:) 30S ribosomal protein S20

SCOPe Domain Sequences for d2v48t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v48t1 a.7.6.1 (T:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkaiqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOPe Domain Coordinates for d2v48t1:

Click to download the PDB-style file with coordinates for d2v48t1.
(The format of our PDB-style files is described here.)

Timeline for d2v48t1: