![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) ![]() |
![]() | Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein) |
![]() | Protein Ribosomal protein S18 [46913] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries) Uniprot P80382 |
![]() | Domain d2v48r1: 2v48 R:19-88 [152536] Other proteins in same PDB: d2v48b1, d2v48d1, d2v48e1, d2v48f1, d2v48g1, d2v48h1, d2v48i1, d2v48j1, d2v48k1, d2v48l1, d2v48m1, d2v48n1, d2v48o1, d2v48p1, d2v48q1, d2v48s1, d2v48t1, d2v48u1, d2v48y1 automatically matched to d2j00r1 complexed with mg, zn |
PDB Entry: 2v48 (more details), 3.8 Å
SCOPe Domain Sequences for d2v48r1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v48r1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]} kakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsakeqrilaktikrarilgl lpfteklvrk
Timeline for d2v48r1: